| Protein or peptide name: | Mtln |
| Chromosome: | 2 |
| Protein or peptide start site: | 127792300 |
| Protein or peptide end site: | 127792467 |
| ncRNA start site: | 127791377 |
| ncRNA end site: | 127792488 |
| Genome Browser: | |
| Protein or peptide sequence: | MADVSERTLQVSVLVAFASGVVLGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA |
| Protein or peptide length: | 56aa |
| ncRNA type: | lncRNA |
| ncRNA name: | 1500011K16Rik |
| Entrez ID: | 67885 |
| Experimental species: | Mus musculus |
| Experimental techniques: | Immunoblotting/Immunocytochemistry/Western blotting |
| Experimental sample (cell line and/or tissue): | Mouse C2C12 myoblast (ATCC, CRL-1772)/Mouse neuroblastoma N2a (ATCC, CCL-131) |
| Description: | We show that a skeletal muscle- and heart-enriched long non-coding RNA, LINC00116, encodes a highly conserved 56-amino-acid microprotein that we named mitoregulin (Mtln). |
| Subcellular location: | inner mitochondrial membrane |
| Function: | Studies in cells and mice demonstrate that Mtln localizes to inner mitochondrial membranes, where it interacts with several complexes to influence mitochondrial membrane potential, respiration, Ca2 retention capacity, ROS,and supercomplex levels. |
| Title of paper: | Mitoregulin: A lncRNA-Encoded Microprotein that Supports Mitochondrial Supercomplexes and Respiratory Efficiency |
| PMID: | 29949756 |
| Year of publication: | 2018 |
